PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family ZF-HD
Protein Properties Length: 246aa    MW: 27960.4 Da    PI: 9.0064
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40227.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.7e-3162116358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  +vrY+eC+kNhAas Ggh+vDGCgEfm+s geegta+++ CaAC+CHR+FHR+ev+
   KFK40227.1  62 SVRYRECQKNHAASSGGHVVDGCGEFMSS-GEEGTAESFLCAACDCHRSFHRKEVD 116
                  79**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-3057125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.3E-2963115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-2964115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.59265114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.25E-16169243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27172244IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-29182239IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEKMENMSKQ NSSANLPPYT YSQTTDKEKP TTKRTGSDPD PDPELDTNPI PIAPAPRSYA  60
RSVRYRECQK NHAASSGGHV VDGCGEFMSS GEEGTAESFL CAACDCHRSF HRKEVDGMFV  120
VKFNSFGHSQ RPLVSRHVSP MMMSFGGGGG AAESSTEDLN KLHHQSFSGK NGVDQFHQYH  180
PKKRFRTKFN QEQKEKMMDF AEKIGWRMTK QEDEQVNLFC REINVKRQVF KVWMHNNKQA  240
GKKKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-211832411876ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064391e-175AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026851e-175CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886165.11e-147ATHB24
SwissprotQ9ZPW71e-141ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A087HDM50.0A0A087HDM5_ARAAL; Uncharacterized protein
STRINGscaffold_304185.11e-147(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-135homeobox protein 24